PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10005596m
Common NameCICLE_v10005596mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 279aa    MW: 30580.2 Da    PI: 8.5871
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10005596mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.32.5e-1637662655
          G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +AtPkti+++m+vkgLtl+h+kSHLQkYRl
  Ciclev10005596m 37 EATPKTIMRTMGVKGLTLYHLKSHLQKYRL 66
                     69***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-153667IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-103767IPR006447Myb domain, plants
SuperFamilySSF466891.24E-53867IPR009057Homeodomain-like
PfamPF143796.5E-27110156IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGMKWGHFIR SIRGVSTRSI MYGATSEIRV QLVVFIEATP KTIMRTMGVK GLTLYHLKSH  60
LQKYRLGKQA CKETTENSKD VSCVAESQDT GSSTTSSTRM VAQDPNDGYQ VTEALRVQME  120
VQRRLHEQLE VQRRLQLRIE AQGKYLQSIL EKACKALNDQ AIVAAGLEAA REELSELAIK  180
VSNDCQGMVP LENIKMPSIS ELAAALESKN ASTIPVRIGD CSVESCLTST SSPVSPMGLG  240
SQAAAMKKRP RPLFGNGESL PLEGNMRQEV EWVMPHIG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247251KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006420903.10.0hypothetical protein CICLE_v10005596mg
TrEMBLV4RJC20.0V4RJC2_9R
STRINGPOPTR_0001s32200.11e-141(Populus trichocarpa)
STRINGPOPTR_0017s08190.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-88G2-like family protein